Convert FASTA to Markdown.
Drop a FASTA file and get a tidy Markdown table of every sequence in seconds. It runs entirely in your browser, so your file never leaves your device.
Drag & drop your files
or
Optimize for AI & RAG
Extra cleanup for LLM ingestion: strip HTML, fix smart quotes, tidy Unicode and spacing.
Add YAML front matter
Prepend a metadata block (title, source, date, word & token counts) for knowledge bases and RAG.
Add table of contents
Build a linked index from the headings. Handy for long documents.
Export RAG chunks (.json)
Split the result into retrieval-ready chunks. Download per file from the result panel.
Most converters quietly upload your documents to a server. This one physically can't.
Many records,
one clear table.
A FASTA file packs every record as a > header line followed by raw sequence lines. Converting turns that into a scannable Markdown table of identifiers, lengths and a short preview.
>seq1 hemoglobin
MVLSPADKTNVKAAWGKVGAHAGEYGAEAL
>seq2
MVHLTPEEKSAVTALWGKVNVDEVGGEALGR
# Sequences (FASTA)
| Identifier | Length | Start |
| --- | --- | --- |
| seq1 hemoglobin | 30 | MVLSPADKTNVKAAWGKVGAHAGEYGAEAL |
| seq2 | 31 | MVHLTPEEKSAVTALWGKVNVDEVGGEALGR |
Everything you
actually need.
FASTA records in, a clean Markdown table out, with no server and no account anywhere.
It never leaves your browser
Your .fasta is read and parsed on your device. Nothing is uploaded to any server, ever.
# Heading
- point one
3 chunks
AI & RAG ready
Optional cleanup, YAML front matter, a table of contents and RAG chunk export.
Works offline
Once the page has loaded you can switch off your connection and it keeps converting.
| Identifier | Length |
| --- | --- |
| seq1 | 30 |
| seq2 | 31 |
Sequences become a table
Each record becomes a row: its identifier, its length and a short preview.
Unicode safe
Accents, symbols and non-Latin scripts come through intact as UTF-8.
Free, and unlimited
No sign-up, no quotas, no watermarks. Convert one file or a thousand; it all runs the same way, on your own device.
What survives
the trip.
Honest about what comes through, and what doesn't. These are the same notes the Formats list shows for FASTA, so the page never drifts from what the converter really does.
Kept
2- Each sequence identifier and length
- The first 30 characters as a preview
Dropped
2- The full sequence beyond the first 30 characters
- Per-line sequence wrapping
FASTA questions,
answered.
Everything worth knowing before you drop in a FASTA file.
Other converters.
Working with more than FASTA? These convert the same way: privately, in your browser.
SBV to Markdown
.sbv
YouTube SBV subtitles.
SubViewer to Markdown
.sub
SubViewer subtitles.
GeoJSON to Markdown
.geojson
Geographic JSON features.
GPX to Markdown
.gpx
GPS tracks & waypoints.
KML / KMZ to Markdown
.kml · .kmz
Google Earth geo data.
TopoJSON to Markdown
.topojson
Topology-aware GeoJSON.
WKT to Markdown
.wkt
Well-Known Text geometry.
OpenStreetMap to Markdown
.osm
OpenStreetMap map data.